SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0019s00690.1|PACid:18220029 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0019s00690.1|PACid:18220029
Domain Number 1 Region: 124-215,351-448,913-1129
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 9.29e-44
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 
Domain Number 2 Region: 449-465,591-680,744-800
Classification Level Classification E-value
Superfamily HAD-like 2.45e-28
Family Meta-cation ATPase, catalytic domain P 0.014
Further Details:      
 
Domain Number 3 Region: 460-644
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.54e-22
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0055
Further Details:      
 
Domain Number 4 Region: 217-350
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.1e-17
Family Calcium ATPase, transduction domain A 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0019s00690.1|PACid:18220029
Sequence length 1152
Sequence
MVTIVPSIDIVDALIVLGGLVSIHVLALLFTAWSVDFKCFVQYSKVNDIYAADSCKVTPA
KFSGSKEVVPLHIRQQSAASSTSGDVEEFYFDFRKQCFIYSKENGTFRKLPYPTKETFGY
YLKSTGHGSEAKVAAAAEKWGRNVFEYPQPTFQKLLKEQCMEPFFVFQVFCVGLWCLDEF
WYYSLFTLFMLFMFESTMAKSRLKTLSELRRVRVDTQTVMVHRCGKWVKLSGTDLLPGDV
VSIGRSSGQNGEDKSVPADLLLLAGSAIVNEAILTGESTPQWKVVSIMGRGTEEKLSAKR
DKNHVLFGGTKILQHTPDKTFPLRAPDGGCLAVVLRTGFETSQGKLMRTILFSTERVTAN
SWESGLFILFLLVFAIIAAGYVLKKASDGLEDPTRSKYKLFLSCSLIITSVIPPELPMEL
SIAVNTSLIALARRGIFCTEPFRIPFAGKVDICCFDKTGTLTSDDMEFCGVVGQTESTDL
ETDMTKVPACTAEILASCHALVFVDNKLVGDPLEKAALKGIDWSYKSDEKAMPKKGGGNA
VQIVQRHHFASHLKRMAVVVRIQEEFLAFVKGAPETIQDRLVDLPSSYVDTYKKYTRQGS
RVLALAFKNLPDMTVGEARSLDRDVVETGLTFAGFAVFNCPIRADSAAVLSELKNSSHDL
VMITGDQALTACHVASQVHIISKPALILCPSSGQGYEWISPDEMEKISYGDKEAEELSET
HDLCIGGDCIEMLQQSSAVLRVIPYVKVFARVAPEQKELILTTFKTVGRITLMCGDGTND
VGALKQAHVGVALLNAVPPTQSGNKSSETPKDGTPKLSKSKKPKPEVSNLNGESSSRGKA
VSRSDSASQSAGNRHLTPAEMQRQRLKKLMEEMNEEGDGRSAPIVKLGDASMASPFTAKH
ASVAPTTDIIRQGRSTLVTTLQMFKILGLNCLATAYVLSVMYLDGVKLGDVQATISGVFT
AAFFLFISQARPLPTLSAERPHPNIFCFYVFLSLMGQFAIHLFFLMSSVKSAEKYMPDEC
IEPDSNFHPNLVNTVSYMVSMMLQLATFAVNYIGHPFNQSITESKPFLYALLAASGFFTV
ITSDLFRNLNDWLKLVPLPPELRNKLLIWAVLMFLSCYTWERLLKWAFPGRIPAWKKRQR
LAVANVEKKKHV
Download sequence
Identical sequences B9IP30
POPTR_0019s00690.1|PACid:18220029 XP_002325729.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]