SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0034s00330.1|PACid:18247161 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0034s00330.1|PACid:18247161
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily SNARE-like 6.41e-27
Family Synatpobrevin N-terminal domain 0.0048
Further Details:      
 
Domain Number 2 Region: 126-192
Classification Level Classification E-value
Superfamily SNARE fusion complex 5.23e-19
Family SNARE fusion complex 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0034s00330.1|PACid:18247161
Sequence length 221
Sequence
MSQESFIYSFVARGTMILAEYTEFTGNFPAIATQCLQKLPSSNDKFTYNCDHHTFNFLVE
DGYAYCVVAKETVSKQISIAFLERMKADFKKRYGGGKADTAAAKSLNKEFGPIMKEHMKY
IIDHAEEIEKLIKVKAQVSEVKSIMLGNIDKAIDRGEAIATLADKTETLRDQAQAYKKQG
TQIRRKMWYQNMKIKLVVLGVLLILVLIIWLSICHGFDCSN
Download sequence
Identical sequences U7E0Y2
3694.eugene3.01320059 XP_006389238.1.11743 POPTR_0034s00330.1|PACid:18247161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]