SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0108s00240.2|PACid:18239601 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_0108s00240.2|PACid:18239601
Domain Number - Region: 173-297
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0314
Family Calcium ATPase, transmembrane domain M 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0108s00240.2|PACid:18239601
Sequence length 307
Sequence
MILMDAAFVIMLLLKWTYTDFRGSRDSIFYPPYKSVDVRVDICLLENQLPFFILEELCGL
SPIFGNSPKATLIGLTHWFFSYEWGSWAVGEYLGGVDFSEVKHLVDFLTIYHRPTEQQQY
EELEVLTAPSVKELHQAGVKFVLSSSKHLLDIKFDRNKGRLEFPRLQLDDRTEIIIRNMQ
AFEQCHGLTHGYVGDYIFLMGLFVSASKDVEMLVENRIIENWLPSNEEVVQLFYNLNKQN
SVWSGTFLFKGLIKDLNAFCERPWNKWKANLKQNYFNTPWAAVSVSGAVILLILTVIQSV
CSILQVV
Download sequence
Identical sequences U7E184
XP_006388739.1.11743 POPTR_0108s00240.2|PACid:18239601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]