SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0108s00240.3|PACid:18239600 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_0108s00240.3|PACid:18239600
Domain Number - Region: 302-426
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0745
Family Calcium ATPase, transmembrane domain M 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0108s00240.3|PACid:18239600
Sequence length 436
Sequence
MESGRPSSTNHELSHQVSLDIDRLAQSVTEELEISNPFSDTCCIYKVPERLRELNEKAYT
PRLVSIGPIHHGNDKLKAMEDHKRMYLKEFIARTKVSVKGFIELIKEKETRLRNCYAETN
GFSSEYFIKMILMDAAFVIMLLLKWTYTDFRGSRDSIFYPPYKSVDVRVDICLLENQLPF
FILEELCGLSPIFGNSPKATLIGLTHWFFSYEWGSWAVGEYLGGVDFSEVKHLVDFLTIY
HRPTEQQQYEELEVLTAPSVKELHQAGVKFVLSSSKHLLDIKFDRNKGRLEFPRLQLDDR
TEIIIRNMQAFEQCHGLTHGYVGDYIFLMGLFVSASKDVEMLVENRIIENWLPSNEEVVQ
LFYNLNKQNSVWSGTFLFKGLIKDLNAFCERPWNKWKANLKQNYFNTPWAAVSVSGAVIL
LILTVIQSVCSILQVV
Download sequence
Identical sequences U7DXA9
3694.grail3.0074000401 POPTR_0108s00240.1|PACid:18239599 POPTR_0108s00240.3|PACid:18239600 XP_006388740.1.11743 XP_006388741.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]