SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_1479s00200.1|PACid:18218408 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_1479s00200.1|PACid:18218408
Domain Number - Region: 42-212
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0157
Family Calcium ATPase, transmembrane domain M 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_1479s00200.1|PACid:18218408
Sequence length 240
Sequence
MAGSNELEEIQEVLRSAGAEVSGRLVQAVVSNQRQQALSREDRSLTSRNYTDSLRNGIGV
LAVLFATLSFQLGMNPPGGSWQDWGSSTTPNFLNVTHKPGKSISWELQKSEALTFFLANA
ICFFTSLTILVFLALTEVSNHVALFKKSQQYWNFMLRTLFGSLLGAAAVEFITGMALVTD
TKYASNICAPAGIVIAYCFLVAFFVLPFCWFVRGRLSSFKTQLKFNLEQSPDHWSRPESR
Download sequence
Identical sequences U7DX61
POPTR_1479s00200.1|PACid:18218408 XP_006387224.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]