SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s05070.1|PACid:18236319 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s05070.1|PACid:18236319
Domain Number 1 Region: 169-249
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 270-300
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000126
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 105-136
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000122
Family CCCH zinc finger 0.0027
Further Details:      
 
Domain Number 4 Region: 39-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000759
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s05070.1|PACid:18236319
Sequence length 304
Sequence
MEFGGGHRKRTRNDAAFNGNGGHKKNRQEMESFSTGIGSKSKPCTKFFSTSGCPFGEGCH
FLHYVPGGFKAVSQMLNVGGSPALPPASRNQGVPTLSYQDRSSPPSVKSRLCNKYNTVEG
CKFGDKCHFAHGEWELGKASAAPSYEDPRAMGPIPGRMSRHMEHPHQGHGAAASFGSSAT
TKISIDASLAGAIIGKNGVNSKHICRVTGAKLSIRDHEADPKKRSIELEGSFDQISQASD
MVRQLISNVGQASGPPIKNQAMHSSGGSNNFKTKICENFNKGSCTFGDRCHFAHGAEELR
KSGM
Download sequence
Identical sequences B9GLM3
XP_002299153.1.11743 POPTR_0001s05070.1|PACid:18236319 3694.estExt_fgenesh4_pm.C_LG_I0043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]