SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s14820.1|PACid:18234441 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_0001s14820.1|PACid:18234441
Domain Number - Region: 7-77
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0199
Family Apolipophorin-III 0.0031
Further Details:      
 
Domain Number - Region: 129-198
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0785
Family SNARE fusion complex 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s14820.1|PACid:18234441
Sequence length 226
Sequence
MEVTTTSSWDALRKQARKLEAQLDEQMNSYRKLASSKGSTKVDSAENDPESGIDRLLKQL
QQVNSQMQAWVSSGGSEMVSHTLTRHQEILQDLTQEFHRLRSGMRAKQEHALLLEDFREF
DRTRLDLEDGVGSADQALLREHASISRNTGQMDNVISQAQATLGSLVLQRSTFGGINSKL
SNVSSRLPTVNQILSAIKRRKSMDSIILSLVASVCTFLIFIYWVTK
Download sequence
Identical sequences B9GMC1
3694.estExt_Genewise1_v1.C_LG_I7426 XP_002299264.1.11743 POPTR_0001s14820.1|PACid:18234441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]