SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0002s15100.1|PACid:18245699 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0002s15100.1|PACid:18245699
Domain Number 1 Region: 2232-2522
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-123
Family BEACH domain 0.0000000107
Further Details:      
 
Domain Number 2 Region: 2645-2714,2752-2866,2908-2955
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.32e-28
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 3 Region: 2114-2218
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-23
Family PreBEACH PH-like domain 0.0014
Further Details:      
 
Weak hits

Sequence:  POPTR_0002s15100.1|PACid:18245699
Domain Number - Region: 388-425,471-615
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000264
Family Clostridium neurotoxins, the second last domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0002s15100.1|PACid:18245699
Sequence length 2984
Sequence
MEEEEENKEIGESCDAQEVDSFVEEGRVGESPQENVNVISRGQEEIENENLVMDGDDSVD
TDDDDQFELVSLKDQEKSFGEFPANNNNSNRSSNSESERFSFDRFGEISPNSYSNYGVEY
DSSSVMEIQHDRSASSPGPETQFGYAIKQSHSSTSLDSGYFIDGFSPTGSPQKVKPKAAM
PNVSPELLHLVDSAIMGKPESLDKLKNIVSGVESFGSGGEAEGIAYLVVDSLLATMGGVE
SFEDEDHNPPSVMLNSRAAIVAGELIPCLPWVGDSEVFMSPRTRMVRGLLAILRACTRNR
AMCSMAGLLGVLLGTAEKIFVQAGGLTEQMKWDGTPLCYCLQYLAGHSLNVVDLHRWLQV
ITRTLTTSWAYRLMLVLEKAMGGKESKGPASTFEFDGESSGLLGPGESRWPFTNGYAFAT
WIYIESFADTLNTATAAAAIAAAAAAKSGKSSAMSAAAAASALAGEGATHMPRLFSFLSA
DNQGIEAYFHAQFLVVESGSGKGKKASLHFTHAFKPQCWYFIGLEHIYKQGLIGKTESEL
RLYIDGSLYETRPFEFPRISKPLAFCCIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKE
PIGPERMARLASRGGDVLPCFGNAAGLPWRATNDHVRAMAEESSLLDAEIGGSIHLLYHP
SLLSGRFCPDASPSGAAGMLRRPAEVLGQVHVATRMRPVEALWALAYGGPISLLPLAVSS
VHKDSLEPEQGNIPITFATATLAAPVFRIISIAIQHPGNNEELCRTRGPEVLSKILNYLL
QTLSSLDAGNCNGVGDEELVAAIVSLCQSQKHNHALKVQLFTTLLLDLRIWSLCNYGLQK
KLLSSLADMVFSESLVMRDANAIQMLLDGCRRCYWTVIEKDSVNTFSSKEATHPVGELNA
LVDELLVIIELLIGAASAAVATDDLRCLLGFMVDCPQPNQVARVLNLIYRLVIQPNTARA
RTFAESFITCGGIETLLVLLQREAKAGEHSIPESVAKSDDSLQVQETELDIGKGTSERRM
NDEKEKDLTSLDQDYESERLDSGGGGSPATSSPGMKIERMSSVSENPFIKNLGGISLSIS
ADNARNNVYNVDKSDGIVVAIIGLIGALVTSGHFKFGSHAPSDTTSTFFGGGLHDGSGTM
FDDKVSLLLFALQKAFQAAPNRLMTTTVYTALLAASINASSTEEGLNFYDSGHRFEHSQL
LLVLLRSLPYASRALQSQALQDLLFLACSHPENRSSLTKMEEWPEWLLEILISNYEMSAT
KDSNVASLGDIEDLVHNFLIIMLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGDQRVR
REESLPVFKRRLLGALLDFAARELQVQTQVIAAAAAGVAAEGLPPKDAKVEADNAAQLSV
ALVENAIVILMLVEDHLRLQSKLSCASRVADSSPSPLSLVSPLNNRSSSLGADSFEALGD
RRSSDSGGLPLDVLASMADANGQISASVMERLTAAAAAEPYESVLCAFVSYGSCMMDLAE
GWKFRSRLWYGVGMSSKTAPFGGGGSGWESWRSTLEKDANGNWIELPLVKKSVAMLQALL
LDESGLGGGLGIGGGSGTGMGGMAALYQLLDSDQPFLCMLRMVLLSMREEDNGETSLLMR
NVSMDDGMSEGFDQQAGNIMCLENSARMPMRQPRSALLWSVLSPVLNMPISDSKRQRVLV
ASCVLYSEVWHAVGRDRKPLRKQYLEGILPPFVAVLRRWRPLLAGIHELATADGLNPLVV
DDRALAADALQIEAALCMISPAWAAAFASPPAAMALAMIAAGAAGGETPAPATTTHLRRD
SSLLERKTARLHTFSSFQKPLEVPNKTPAHPKDKAAAKAAALAAARDLQRNAKIGSGRGL
SAVAMATSAQRRNASDMERVRRWNIAEAMGVAWMECLQPADTRSVYGKDFNALSYKFIAV
LVASFALARNMQRLEVDRRAQVDVISRHRLSSGIHAWRRLIHCLIEMKSLFGPFGDSLCN
PERVFWKLDFMETSSRMRRCLRRNYKGSDHFGAAANYEDQIEIKHDKGNVPVLAAEAISV
EGLNEDGERTEIENFDGRSFDTEQSGESQLSLSGATDQNMQPPAEPNDIQLARDQDLENA
SAVAPGYVPSELDERIILELPSSMVRPLTVMRGTFQVTTRRINFIVNTTESNADGMESSE
SGVQEKDHSWLMSSLHQIYSRRYLLRRSALELFMIDRSNFFFDFGSTEARRNAYRAIVQS
RPPHLNNIYLATQRPEQLLKRTQLMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFP
WVLSDYNSKSLDLSDASSYRDLSKPVGALNPDRLKKFQERYSSFDDPVIPKFHYGSHYSS
AGTVLYYLVRVEPFTTLSIQLQGGKFDHADRMFSDIAATWNGVTEDMSDVKELVPELFYL
PEILTNENSIDFGTTQLGGKLDSVKLPPWAENTTDFIHKHQMALESEHVSAHLHEWIDLI
FGFKQRGKEAIAANNVFFYITYEGAVDIDKISDPAQQHATQDQIAYFGQTPSQLLTAPHL
KRMPLADVLHLQTIFRNPKEVKPYAVPAPERCNLPAASIHASSDAVIIVDINAPAAHIAQ
HKWQPNTPDGQGTPFLFQHGKALTSSAGGTFMRMFKGQSVSGGDEWHFPQALAFASSGIR
SKAVVSITHDKEIITGGHADNSIKLISADSAKTLETAIAHCAPVTCLALSPDGNYLVTGS
RDTTVLLWKMHRAFTSSSSSISDPSTGTGTPPAAGSTLATNLAEKSRWRRIEGPIHVLRG
HHREILCCCVSSDLGIVVSCSQSSDVLLHSIRRGRLIRRLFGVEAHSVFLSSEGVVMTWN
KCQNSLNTYTLNGILIARAQLPLSGSVSCIEISVDGKCALIGMNSCPENHGSSNNSQNLS
LKKTGAADFDLESVDTGEDNRLDVPAPSICFLDLYTLKVFHVLKLGEGQDITALALNNDS
TNLVVSTADKQLIIFTDPALSLKVVDQMLKLGWEGDGLSPLIKS
Download sequence
Identical sequences B9GPI9
XP_002302548.2.11743 POPTR_0002s15100.1|PACid:18245699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]