SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s21810.1|PACid:18217739 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s21810.1|PACid:18217739
Domain Number 1 Region: 167-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.29e-25
Family B3 DNA binding domain 0.00022
Further Details:      
 
Domain Number 2 Region: 44-101
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000262
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s21810.1|PACid:18217739
Sequence length 369
Sequence
MEDQDASSSMISSAKSPTINVETLAFSTSNKLGRLHSNIGNVAKFKGIVPQKNGHWGAQI
YSNHQRIWLGTFKTEKEAAMAYDSAAIKLRSTDSHRNFPWNDRNVQEPSFQNQYSTEEIL
NMIRDGSYQQIFVDFIMKQSQREEIGGSDDPNGRRVHADDEQFSCIQLFQKDLTPSDVGK
LNRLVIPKKFAVKYFPNIFKDVEDDRVLNAAGVDDTELIFYDRFMKSWKFRYCYWRSSQS
FVFTKGWNRFVKEKKLKEKDIIIFYTCACPNKVLEQHGQGQYFSMIDVVYCNGQGGKVDG
FNQTEDVQRELAVVLRQNMRKKLQKDGKELKEEKETLKNKVKQKGFRLFGVQINEVELQL
QPCFQTGTE
Download sequence
Identical sequences B9GYV2
XP_002304025.1.11743 3694.eugene3.00031908 POPTR_0003s21810.1|PACid:18217739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]