SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s02760.1|PACid:18226465 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s02760.1|PACid:18226465
Domain Number 1 Region: 255-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-57
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 
Domain Number 2 Region: 3-163
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-51
Family Protein kinases, catalytic subunit 0.00054
Further Details:      
 
Domain Number 3 Region: 163-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000393
Family alpha-D-mannose-specific plant lectins 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s02760.1|PACid:18226465
Sequence length 526
Sequence
MEEIAVKRLSKTSGQGMKEFMNEVRLISKLQHRNLVKLFGYETKRVLLDWSKRFEIVSGI
ARGVLYLHQDSRLKIIHRDLKASNILLDAAMNPKISDFGMARMFMEDQVQGKNTRVVGTY
GYMSPEYAIHGQYSIKSDVFSYGVLTLEIISGRKNSDYEEETSLWDNPINDTSGVLSING
QDNLVLYGKNTKFISPVWFTNVSVVSSASNSMAQLLNSGNLVLTQSNRHQSTFKQDNRPS
FLWLIVTPPLSRILPNYAEIAVKRLSKTSGQGMKEFMNEVRLISKLQHRNLVKLFDETKR
VLLDWSKRFEIVSGIARGVLYLHQDSRLKIIHRDLKASNILLDAAMNPKISDFGMARMFM
EDQVQGKTTRVVGTYGYMSPEYAIHGQYSIKSDVFSYGVLTLEIISGRKNSDYGEKEPWL
NLIGHVWDLWREEKALDIVDPMLEQACPPHEVLRCVQIGLLCVQEFPDDRPAMLEVVFML
GNEIALPSPKKPAFVLRTRSGQDLPAMSRRAACSVNEVTVTMVEAR
Download sequence
Identical sequences U5GE08
XP_006383976.1.11743 POPTR_0004s02760.1|PACid:18226465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]