SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s19560.1|PACid:18248175 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s19560.1|PACid:18248175
Domain Number 1 Region: 33-120,238-365,781-1004
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.27e-49
Family Calcium ATPase, transmembrane domain M 0.028
Further Details:      
 
Domain Number 2 Region: 558-617,675-780
Classification Level Classification E-value
Superfamily HAD-like 2.36e-33
Family Meta-cation ATPase, catalytic domain P 0.059
Further Details:      
 
Domain Number 3 Region: 378-407,436-554
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00000000000916
Family Metal cation-transporting ATPase, ATP-binding domain N 0.016
Further Details:      
 
Domain Number 4 Region: 117-161,196-234
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000327
Family Calcium ATPase, transduction domain A 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s19560.1|PACid:18248175
Sequence length 1098
Sequence
MPSRNVTLGRVQPQAPGHRTIYCNDRDANLPVRFKGNSISTTKYNFFTFFPKGLFEQFRR
VANCYFLMISILSTTPISPVNPVTNVVPLTLVLLVSLIKEAFEDWKRFQNDMVINNTLID
VLQDEKWVAVPWKKLQVGDIIRTANLDGETNLKIRKALERTWDYLTPEKAAEFKGEVQCE
QPNNSLYTFTGNLMFQKQTLPLSPNQILLRGCSLRNTEYIVGAVVFTGHETKVMMNSMNV
PSKRSTLERKLDKLILALFGTLFMMCLIGAIGSGIFINRKYYYLGLDKGVAAEFNPSNRF
VVAALTFFTLITLYSTIIPISLYVSIEMIKFIQSTQFINKDLHMYHAETNTPALARTSNL
NEELGQVEYIFSDKTGTLTRNLMEFFKCSIGGEVYGSGVTEIEQGGAQRNGIKVQELRKS
TPAIQEKGFNFDDHRLMRGAWRNEPNSDSCKEFFRCLAICHTVLPEGDESPEKITYQAAS
PDEAALVTAAKNFGFFFYRRTPTMIYVRESHVEKMGKIQDVAYEILNVLEFNSTRKRQSV
VCRYPNGRLVLYCKVAELIEKDLILIGSTAIEDKLQEGVPACIETLSRAGIKVWMLTGDK
METAINIAYACNLINNEMKQFIISSETDAIREVENRGDQVESARFIKEEVKKELKKYLEE
AQHYLHSAPGPKLTLVIDGKCLMYALDPTLRVMLLNLSLNCTSVVCCRVSPLQKAQVTSL
VKKGARKITLSIGDGANDVSMIQAAHIGIGISGMEGMQAVMASDFAIAQFRFLTDLLLVH
GRWSYLRICKVITYFFYKNLTFTLTQFWFTFQTGFSGQRFYDDWFQSLYNVIFTALPVII
VGLFDKDVSASLSKKYPELYREGIRNVFFKWRVVVTWACFSVYQSLVFYHFVIASSASGK
NSSGRMLGQWDISTMAFTCVVITVNLRILMICNSITRWHYISVGGSILAWFMFIFVYSVL
RENVFFVIYVLMSTFYFYLTVLLVPIVALFGDFIYQGIQRWFFPYDYQIVQEIHRHELED
NTSAGLLDVGSQLTPQEEMSYAIAQLPREISRHTGFAFESPGYESFFAAQQGIQAPQKPW
DVARRASMKSKRKMPKRN
Download sequence
Identical sequences B9HLU4
POPTR_0008s19560.1|PACid:18248175 XP_002311782.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]