SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s01690.1|PACid:18222532 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s01690.1|PACid:18222532
Domain Number 1 Region: 119-237,337-448,806-1017
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.44e-111
Family Calcium ATPase, transmembrane domain M 0.00098
Further Details:      
 
Domain Number 2 Region: 452-472,609-861
Classification Level Classification E-value
Superfamily HAD-like 2.2e-56
Family Meta-cation ATPase, catalytic domain P 0.00021
Further Details:      
 
Domain Number 3 Region: 460-665
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.4e-47
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0025
Further Details:      
 
Domain Number 4 Region: 238-334
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.48e-25
Family Calcium ATPase, transduction domain A 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s01690.1|PACid:18222532
Sequence length 1020
Sequence
MENYLNENFGDVKAKNSSDEALQRWRKLCWLVKNRKRRFRFTANLSKRFEAEAIRRSNQE
KLRVAVLVSKAALQFIHCLNLSSDYVVPKEVEEAGFQICADELGSIVEGHDVKKLKIHGE
VEGIAEKLSTSINDGISTSEDLVNGRKEIYGINKFTESPPRGFLVFVWEALQDMTLMILG
VCALVSLIVGIAMEGWPKGSHDGLGIVASILLVVFVTATSDYKQSLQFKDLDREKKKITV
QVTRNAVRQKISIYDLLPGDIVHLFIGDQVPADGLFVSGFSVLINESSLTGESEPVNVNA
ANPFLLSGTKVQDGSCKMLVTTVGMRTQWGKLMATLSEGGDDETPLQVKLNGVATIIGKI
GLFFAVVTFAVLVQGLCNRKLREGTHWIWSGDDAREMLEFFAVAVTIVVVAVPEGLPLAV
TLSLAFAMKKMMNDKALVRNLAACETMGSSTTICSDKTGTLTTNHMTVVKACVSGETREV
GSSESTTSFGSAIPDLAKSVLLESIFNNTGGEVVVNEERKVQILGTPTETALLEFGLLLG
GDSRQKQEKSKIVKVEPFNSTKKRMGVVIELPNGGFRAHCKGASEIVLAACDKVIDSNGV
VVPLDEASINHLNDTIERFASESLRTLCLAYLEIGNEYSDESPIPSKGYTCIAIVGIKDP
VRPGVKESVAICRSAGIVVRMVTGDNLTTAKAIARECGILTDDGIAIEGPAFREKSEEEL
QELIPKIQVMARSSPLDKHALVRHLRTTFQEVVAVTGDGTNDAPALHEADIGLAMGIAGT
EVAKESADVIILDDNFSTIVTVAKWGRSVYINIQKFVQFQLTVNVVALIVNFSSACLTGN
APLTAVQLLWVNMIMDTLGALALATEPPNDDLMKRSPVGRKGNFISNVMWRNILGQSLYQ
FVVIWYLQTRGKAVFRIDGPDSDLILNTLIFNSFVFCQVFNEISSREMEKINVFKGILKN
YVFVSVLACTAFFQIIIVEFLGTFANTSPLSWQQWFVSVFFGFLGMPIAAALKMIPVVSN
Download sequence
Identical sequences B9IBR9
POPTR_0014s01690.1|PACid:18222532 3694.estExt_Genewise1_v1.C_LG_XIV0616 XP_002320033.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]