SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s04590.1|PACid:18250365 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s04590.1|PACid:18250365
Domain Number 1 Region: 162-230
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000628
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 249-280
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000128
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 90-122
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000968
Family CCCH zinc finger 0.0023
Further Details:      
 
Domain Number 4 Region: 35-61
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000406
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s04590.1|PACid:18250365
Sequence length 284
Sequence
MDTRKRGRPDFGTNGYGGFKKSKQEMDSLSTGVGSKSKPCTKFFSTAGCPFGESCHFLHH
VPGGYKAVAQMVNLGPTVALPPVPNSSAPSAVKSRLCKKYNSAEGCKFGDKCHFAHGEWE
LGKAFVPSHNDPHAVGSVPGHLGGRVEPPPPGPATSFGVFATTTRISVDASLAGSIIGKA
GVHSKQICRQTGIKLSIKDHETNPNLKNIELEGSLEQIAQASKMVEELVRVTSANAAAKS
SGGHANPGSNYKTKLCDNFAKGSCTFGQRCHFAHGAAELRKSSM
Download sequence
Identical sequences U5FQC5
XP_006373740.1.11743 POPTR_0016s04590.1|PACid:18250365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]