SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121829588|gb|EAX66672.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121829588|gb|EAX66672.1|
Domain Number 1 Region: 2-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.59e-53
Family Ankyrin repeat 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121829588|gb|EAX66672.1|
Sequence length 222
Comment hypothetical protein TVAG_508870 [Trichomonas vaginalis G3]
Sequence
MLRAINGHTRVLRLLLSDPSIDVNATNNSSRTALIRAARDGHFEALELLLSFPGIEKNIV
DKKNRSALHYAVLLHHKQCVECLLNDKDVNPQLPDDSSFTPLHIAASNDFSDLIRLFADR
DDVDLNCVDSIQWTPLHVAAKCGSTSFVEELLQHENVDVNRQNLMKRTPIFNAIENEKIE
VVKVLFSREDLDLSVVDSEGHTAKDVALQTKNEDIINLLLNK
Download sequence
Identical sequences A2HN10
gi|121829588|gb|EAX66672.1| gi|121837838|gb|EAX68989.1| gi|121838575|gb|EAX69207.1| gi|123170864|ref|XP_001279602.1| gi|123188819|ref|XP_001281919.1| gi|123189773|ref|XP_001282137.1| 100717.m00003 110908.m00003 145076.m00003 XP_001279602.1.43485 XP_001281919.1.43485 XP_001282137.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]