SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121833289|gb|EAX67715.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121833289|gb|EAX67715.1|
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.17e-48
Family Ankyrin repeat 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121833289|gb|EAX67715.1|
Sequence length 196
Comment hypothetical protein TVAG_523140 [Trichomonas vaginalis G3]
Sequence
NNSSRTALIRAARDGHFEALELLLSFPGIEKNIVDKKNRSALHYAVLLHHKQCVECLLND
KDVNPQLRDDSSFTPLHIAASNDFSDLIRLFADRDDVDLNCVDSIQWTPLHVAAKCGSTS
FVEELLQHENVDVNRQNLMKRTPIFNAIENEKIEVVKVLFSREDLDLSVVDSEGHTAKDV
ALQTKNEDIINLLLNK
Download sequence
Identical sequences A2HSA2
XP_001280645.1.43485 106184.m00003 gi|121833289|gb|EAX67715.1| gi|123182289|ref|XP_001280645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]