SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121856936|gb|EAX75244.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|121856936|gb|EAX75244.1|
Domain Number - Region: 27-106,220-230
Classification Level Classification E-value
Superfamily ARM repeat 0.000806
Family Armadillo repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121856936|gb|EAX75244.1|
Sequence length 240
Comment hypothetical protein TVAG_602240 [Trichomonas vaginalis G3]
Sequence
MKLQSDEYFSLNNQGNTPYNRIYTNTVKETITAYTKLCQLVPNQDQLTDIICSYLPIFAE
CVEGRTLLQACLRMPPNLRQQFAQIVHEFKAFNNGYDEDEVADEFGEEKTFFPSYNTPAT
VFPTNEFHNYCVVHLIVVDMPTGEDILSGDFIEVCINTELGEDELHKFSYVEHIFKPAHQ
LFIETEITLTQNMSISFKSKSGRPYRIWMNYVLFHSADDDEEEEEEEEEEEESSEFTPED
Download sequence
Identical sequences A2H5S4
gi|121856936|gb|EAX75244.1| gi|123242145|ref|XP_001288174.1| 142872.m00006 XP_001288174.1.43485 5722.A2H5S4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]