SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121864185|gb|EAX77976.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|121864185|gb|EAX77976.1|
Domain Number - Region: 100-129
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0156
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121864185|gb|EAX77976.1|
Sequence length 158
Comment hypothetical protein TVAG_484790 [Trichomonas vaginalis G3]
Sequence
MTSKEEDEYIKQKRMLTEERRSSSLLPGTKVRIILEHKPHEKVRNQLSDDYYIVDSSQGN
GYLIKAADHSVAFYPRFRLVESENGRLAKTVDEAKRGIVNKIVSYDEDKDEYTVIYEGGV
DDKIPSRNLRESNPTHLSELEKDYWKNKNKPKLIKKFL
Download sequence
Identical sequences A2GXZ1
XP_001290906.1.43485 97036.m00003 5722.A2GXZ1 gi|121864185|gb|EAX77976.1| gi|123298567|ref|XP_001290906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]