SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121869010|gb|EAX79964.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121869010|gb|EAX79964.1|
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Flavoproteins 0.00000067
Family Quinone reductase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121869010|gb|EAX79964.1|
Sequence length 76
Comment modulator of drug activity B, putative [Trichomonas vaginalis G3]
Sequence
MLSFTWNAPVESLTDPNQFFKGLGADSVHGPIIRSHEFCGMKQIPSFQCNDVIKNPDFDS
YIKNYEAHLTQYFGKQ
Download sequence
Identical sequences A2EVC4
gi|121869010|gb|EAX79964.1| gi|121898275|gb|EAY03370.1| gi|123318262|ref|XP_001292894.1| gi|123455704|ref|XP_001315593.1| XP_001292894.1.43485 XP_001315593.1.43485 5722.A2EVC4 90192.m00008 97179.m00111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]