SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121878745|gb|EAX85320.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121878745|gb|EAX85320.1|
Domain Number 1 Region: 9-116
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000253
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|121878745|gb|EAX85320.1|
Domain Number - Region: 219-248
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0902
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121878745|gb|EAX85320.1|
Sequence length 277
Comment hypothetical protein TVAG_169610 [Trichomonas vaginalis G3]
Sequence
MLTLVKHMHIPMRNKGTREVLRVLQKFAAEHNPSTLTSDQDSAYLSNEITEFLIKHNITH
YTTEDHNHNILGIINRFIRTLRDLNQERDFTEETMKHFIEVYNSSTHSKTGHTPNSMTQQ
QEEKYIQKKRSQTQNIRNSTQFTLIPGTKVCVVLDDKPLTKKRLRLSRNYYIVDSTQGNG
YLIKAADDSIAFYPRHKLVESSNGELAETIDEAKRGVVIEILGYNINDDTYKVRYEGGVE
DVIPSKNLRESKPTHLGPLEREYWKDKNMPERIRKFF
Download sequence
Identical sequences A2GBZ5
85988.m00016 gi|121878745|gb|EAX85320.1| gi|123378895|ref|XP_001298250.1| XP_001298250.1.43485 5722.A2GBZ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]