SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121883745|gb|EAX89525.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121883745|gb|EAX89525.1|
Domain Number 1 Region: 28-280
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.29e-78
Family Protein kinases, catalytic subunit 0.00000223
Further Details:      
 
Weak hits

Sequence:  gi|121883745|gb|EAX89525.1|
Domain Number - Region: 4-39
Classification Level Classification E-value
Superfamily PH domain-like 0.00283
Family Pleckstrin-homology domain (PH domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121883745|gb|EAX89525.1|
Sequence length 281
Comment AGC family protein kinase [Trichomonas vaginalis G3]
Sequence
MESIDSCKFSIETEGSTEPLYFRAPSTESLLQWIHALRSCTYTHQSLTIESFKVLSVLGR
GNYGKVMLAEKIDSGELFAIKSVHKKRLALAGKVHTMLSERNTLINASNPFIVKLFYAFQ
NATKFYLVLEYVPGGEMFNYMSTNGAVPLEDARIYAAEIVTALHFLHQNDIIYRDLKPEN
ILLAQDGHIKLTDFGFAKDLSQSEVTKTFCGTNEYLAPEVISRVNYGPAVDWWTLGILLY
EMLFQTTPFFHQNTSRMFTRILMDPVVFPKGADPDVCSLIT
Download sequence
Identical sequences A2FZY1
XP_001302455.1.43485 92750.m00049 gi|121883745|gb|EAX89525.1| gi|123404560|ref|XP_001302455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]