SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121886495|gb|EAX92075.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121886495|gb|EAX92075.1|
Domain Number 1 Region: 21-62
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000752
Family Tudor domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121886495|gb|EAX92075.1|
Sequence length 202
Comment hypothetical protein TVAG_441780 [Trichomonas vaginalis G3]
Sequence
MPNHFPKFAYTQNPNLHVGQEIFIIDENKYDIYRAEILNIQDGTYTIFYPDYDMTETIDS
IDRILLKNNVNKKIFKEQELIRMKKEAENKAQLRSESDGESDEDEEKNPDIKPPKIPEKF
RERTRIQPHETVDRNPLPPEPPKPPEWGHQAVEVAPNITIPITINADDSKVLYDQPKNIE
ISTSKSSDSNEVTFSFKITFKK
Download sequence
Identical sequences A2FSP4
95580.m00071 5722.A2FSP4 gi|121886495|gb|EAX92075.1| gi|123416964|ref|XP_001305005.1| XP_001305005.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]