SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121892758|gb|EAX98037.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121892758|gb|EAX98037.1|
Domain Number 1 Region: 181-232
Classification Level Classification E-value
Superfamily RING/U-box 0.000000182
Family RING finger domain, C3HC4 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121892758|gb|EAX98037.1|
Sequence length 242
Comment hypothetical protein TVAG_275470 [Trichomonas vaginalis G3]
Sequence
MGCASCLPLQQPLWYEYYGPIRRVEAANAINAAIADNLNFDNAMTRVPIRKVTAPHIKVP
GALNKPIVANLTDTTVTISFSTKAAGTMTLSANESSEALEFANALNQTLTFNRPTDEQWT
IKFDFEDGEEVSCRIIKLNAKTPSSPIVADDKIVINGKISTINKVFREEDEGSDGGFNDG
MCLICCSAESTVIAFPCRHCCMCSECAERFATMTIHCPVCRAIVTELIDCAPNQEQNPPP
PP
Download sequence
Identical sequences A2FAQ1
XP_001310967.1.43485 gi|121892758|gb|EAX98037.1| gi|123444392|ref|XP_001310967.1| 5722.A2FAQ1 89397.m00111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]