SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121901227|gb|EAY06244.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121901227|gb|EAY06244.1|
Domain Number 1 Region: 172-315
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-30
Family Ankyrin repeat 0.00084
Further Details:      
 
Weak hits

Sequence:  gi|121901227|gb|EAY06244.1|
Domain Number - Region: 104-189
Classification Level Classification E-value
Superfamily t-snare proteins 0.00392
Family t-snare proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121901227|gb|EAY06244.1|
Sequence length 328
Comment ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Sequence
MTESFLNEIMNHTVTKKYSKQDIMHILDNSVLNFDQATLLIYEVSETFSQADIFNLLKHI
SINFNSKFEALQSFLVLLSIKLEIPFFKDLSTYLQDNMNAKSQVASAIQEKINLLTNQNN
AILSQISVQLNSLKNATVSAEPKEQKPQPTKISNENIKQLMQYEKDKSHYAYIYKILEKS
ASENDKEALKFSIDSKYAEITDDFLDNMLLKAADLNNLQLARYLVELGMDPNVTNRGSLT
PLHYFCRNGNLEAAKFFCSLKGINVNAKHYQGWTPLHYACFESNIPLVEFLVTVDGLRIN
ETDNYGNTPYQSPTSPKVKEILSSKGGK
Download sequence
Identical sequences A2EM60
gi|121901227|gb|EAY06244.1| gi|123470524|ref|XP_001318467.1| 81512.m00112 5722.A2EM60 XP_001318467.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]