SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121901409|gb|EAY06422.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|121901409|gb|EAY06422.1|
Domain Number - Region: 4-52
Classification Level Classification E-value
Superfamily RING/U-box 0.000257
Family RING finger domain, C3HC4 0.033
Further Details:      
 
Domain Number - Region: 89-142
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.017
Family DNA primase zinc finger 0.066
Further Details:      
 
Domain Number - Region: 205-247
Classification Level Classification E-value
Superfamily beta-carbonic anhydrase, cab 0.0183
Family beta-carbonic anhydrase, cab 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121901409|gb|EAY06422.1|
Sequence length 394
Comment Zinc finger, C2H2 type family protein [Trichomonas vaginalis G3]
Sequence
MEDSRVYCDICSEPINIRVLQHCGHNDICLQCYIRYSKNYGNNCCYYCQQNNDGSWPIAT
SKLNLDYESAKQLNLEFDDANKIYYTDPAAKKEIKNLNMFNCHHCHHKFHNINQFSKHLE
KHGETICRICQGSGRFNPHSLETFTKAEIHKHIHQHHPRCICCKSLFFDQHTLAEHMNES
HQRCEICAKNNKIIWFNTPQDLIEHNEKEHFVCHHQDCAAMQLVAFATRGELLLHLQRVH
HDFDNEIDFMRDFEVEETTTNTKSNNYRSEFINIYKKKVWEILKAKPKVEKYSSAFNSFI
KNRISCAEFYKLFSEFFGESKNMIFCDMIATLRDSTKRMELFRIHNGIKDEPLPSHKLII
DEPIEEEKPSIKKVTVKHNDSPRRKKVVRVISSF
Download sequence
Identical sequences A2ELQ7
gi|121901409|gb|EAY06422.1| gi|123470884|ref|XP_001318645.1| 5722.A2ELQ7 XP_001318645.1.43485 94219.m00120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]