SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121902660|gb|EAY07644.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|121902660|gb|EAY07644.1|
Domain Number - Region: 81-119
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000748
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121902660|gb|EAY07644.1|
Sequence length 126
Comment hypothetical protein TVAG_430080 [Trichomonas vaginalis G3]
Sequence
MMAYENQAEDWPEIPEIELELVQNDANKIQQTKVRRIHAHPANTVNTAKITEIEDRIHNV
EQNVEKIFDLITKIKAVGTTTHDDVHNCASCFTPNAKECPYCHVYYCDTCMNKAIRHKCA
EKQHQQ
Download sequence
Identical sequences A2EI84
XP_001319867.1.43485 95238.m00100 gi|121902660|gb|EAY07644.1| gi|123473357|ref|XP_001319867.1| 5722.A2EI84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]