SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121902788|gb|EAY07769.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121902788|gb|EAY07769.1|
Domain Number 1 Region: 194-328
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.09e-19
Family Staphylococcal nuclease 0.0024
Further Details:      
 
Domain Number 2 Region: 110-191
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000115
Family Staphylococcal nuclease 0.015
Further Details:      
 
Domain Number 3 Region: 526-604
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000012
Family Tudor domain 0.015
Further Details:      
 
Domain Number 4 Region: 352-483
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000235
Family Staphylococcal nuclease 0.023
Further Details:      
 
Domain Number 5 Region: 496-513,592-703
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000222
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121902788|gb|EAY07769.1|
Sequence length 708
Comment hypothetical protein TVAG_000530 [Trichomonas vaginalis G3]
Sequence
MNNQGFLGVNSDQAKSDATKSVNIGKDVDAGTLGNLNKIAKSNEIKDPHPLSDKELAENA
QLRITLLGISMESFLFICVNENGVKFPVELAGIAHTNITSSSPIIRNLFIDFFVENLLDK
QFLLRIHTKSPNGYVGTLTQGNRDIGATMLIKGIVRFNSLTSNYLSKPNHFQALETTAKR
QGTGIWADTNYKEIRTKPFPAQILAIPSSNTFTIINESGDEELFYLSTVHCPDFSFNGIS
EPFGFEAWNFIRETVIGKEVYITLDDDRADKKFATIKIGNEILNEMLCRKGLALLSINRV
RKNSDYIEQIRNAYLYAQENQIGIFGSEIPKPVLVKELNREDRDLLMADEYSRNVRAIIV
EVTGSVYLKLFVPSLQTILRVSLVGLVPLQSNDWTSRRAMEVLRRCFLHHEVDVTITRYA
EHSRYYRVLIYDSISKLDARVPPVHEGLVHYNKLATDDPSTNKDELEQHAEEARSKSIGI
FKSEGRNSSQIPKDKAIPVIITKVIDETTYAVQAQNDNSTKVNELLKADFPQLELLPMED
QYVIMVRNGVNYRAQVVRNRGPEVFVNLIDYGVDVWSFVSDLRKYDDELMQYQPNGFVVS
LAFIQPFRNRSKQFTETCLNYIANIFALGNSVYIRRPFDRELPCVMMMMNDTPAAMTLQY
ALVHDGICTVIDEDVHQLFLPVVKELRKVMANAKENKFGGWSLQESLI
Download sequence
Identical sequences A2EHS9
80222.m00152 XP_001319992.1.43485 5722.A2EHS9 gi|121902788|gb|EAY07769.1| gi|123473610|ref|XP_001319992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]