SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121903947|gb|EAY08904.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121903947|gb|EAY08904.1|
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.85e-46
Family Ankyrin repeat 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121903947|gb|EAY08904.1|
Sequence length 269
Comment ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Sequence
MTPLACAIMNKNLDLVKILIKNGANVNRQILPITFGLFWHTPLTVAIRNASLEIVKELVE
NDANVNKHVASFPDDNPESKGDDKVIETPLTLACQYDLYDIIEYLVEHGADVNKPVMYSL
VGDTSYTALSVAVKHENEKIANYLISHGANINAVIVEDEENNTPLTIAVAENKLTMMATL
VMSGADVNQVVENSILQSTKTALTIATENNNVNIVEFLLKHGADVNKQVIYDGKQATALT
IAKINNFKMIEQMLTNHTEPQKSRCCTIA
Download sequence
Identical sequences A2EEJ7
5722.A2EEJ7 XP_001321127.1.43485 96280.m00153 gi|121903947|gb|EAY08904.1| gi|123475904|ref|XP_001321127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]