SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121907409|gb|EAY12302.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|121907409|gb|EAY12302.1|
Domain Number - Region: 70-110
Classification Level Classification E-value
Superfamily vWA-like 0.000889
Family Integrin A (or I) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121907409|gb|EAY12302.1|
Sequence length 126
Comment alpha kinase, putative [Trichomonas vaginalis G3]
Sequence
MITGAKNISKTLIRYINDKYSSCDVQYSAVFFRDMAMARYVGHTLWNYPDIFDFQSSNFF
SPDRFDYVSCGGGAGDGPEDWVQAFDGVLGMNWRSKSKKIMIMITDASCHGNSFDSKLDY
TKRVND
Download sequence
Identical sequences A2E4W3
XP_001324525.1.43485 85781.m00216 5722.A2E4W3 gi|121907409|gb|EAY12302.1| gi|123485588|ref|XP_001324525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]