SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121909451|gb|EAY14312.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|121909451|gb|EAY14312.1|
Domain Number - Region: 9-44
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00746
Family DNA repair protein Rad51, N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121909451|gb|EAY14312.1|
Sequence length 51
Comment hypothetical protein TVAG_026330 [Trichomonas vaginalis G3]
Sequence
MSEEEAELKLMPNIGETIAKKLNEVGVKTSTDLKKLGSKKAFELIRNKTVM
Download sequence
Identical sequences A2DZ36
5722.A2DZ36 81190.m00248 gi|121909451|gb|EAY14312.1| gi|123494540|ref|XP_001326535.1| XP_001326535.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]