SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121914573|gb|EAY19370.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121914573|gb|EAY19370.1|
Domain Number 1 Region: 4-40
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000118
Family Ankyrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121914573|gb|EAY19370.1|
Sequence length 44
Comment hypothetical protein TVAG_100860 [Trichomonas vaginalis G3]
Sequence
MEHHWKVCFNIIETAVVLLSHGADINEKVKDDQTPLHIAVKIIV
Download sequence
Identical sequences A2DJH0
5722.A2DJH0 gi|121914573|gb|EAY19370.1| gi|154414659|ref|XP_001580356.1| XP_001580356.1.43485 83714.m00298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]