SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123179965|ref|XP_001280294.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123179965|ref|XP_001280294.1|
Domain Number 1 Region: 35-179
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.97e-17
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|123179965|ref|XP_001280294.1|
Domain Number - Region: 279-308
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0872
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123179965|ref|XP_001280294.1|
Sequence length 337
Comment Integrase core domain containing protein [Trichomonas vaginalis G3]
Sequence
AKNAGFNDRTEIKRFYDENIVHQVKVNPYDYYLPIYSKTHDAYQFDILVQSKKGRKPPFL
IFINVNTRKAFAYIMKNKGTKEVLRVLQTFVAEHHPTSLTSDQDSAYLSNEITEFLIKHN
VTHYTTEDHNHNILGIINRFIRTLRDLNKERDFTEESMNKVINAYNKSTHNSTGLKPNEM
TSKEEDEYIKQKRMLTDERRSSSLLPGTKVRIILEHKPHEKVRNQLSDDYYIVDSSQGNG
YLIKAADHSVAFYPRFRLVESENGRLAKTVDEAKRGIVNKIVSYDEDKDEYTVVYEGGVD
DKIPSRNLRESNPTHLSELEKDYWKDKNKPKLIKKFL
Download sequence
Identical sequences A2HTA3
137635.m00003 XP_001280294.1.43485 gi|121832077|gb|EAX67364.1| gi|123179965|ref|XP_001280294.1| 5722.A2HTA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]