SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123399356|ref|XP_001301456.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|123399356|ref|XP_001301456.1|
Domain Number - Region: 86-115
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.022
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123399356|ref|XP_001301456.1|
Sequence length 144
Comment hypothetical protein [Trichomonas vaginalis G3]
Sequence
MLTEERRSSSLLPGTKVRIILEHKPHEKVRNQLSDDYYIVDSSQGNGYLIKAADHSVAFY
PRFRLVESENGRLAKTVDEAKRGIVNKIVSYDEDKDEYTVVYEGGVDDKIPSRNLRESNP
THLSELEKDYWKDKNKPKLIKKIL
Download sequence
Identical sequences A2G2T9
XP_001301456.1.43485 96132.m00046 gi|121882639|gb|EAX88526.1| gi|123399356|ref|XP_001301456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]