SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123406084|ref|XP_001302733.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123406084|ref|XP_001302733.1|
Domain Number 1 Region: 8-253
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-69
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123406084|ref|XP_001302733.1|
Sequence length 298
Comment STE family protein kinase [Trichomonas vaginalis G3]
Sequence
MELCDAEFFLENGFDYVSTIGRGTYGLIYQVYDHQYSQNFALKRVLETDFNENEVKCMIE
IRSNNIVPLYKYYRFKQFVYLLMEYCPLNIERSIVHSSKINLDKQYDIALGISEAVYSCH
KYCIAHGDIKPSNFLLDKYGRIKICDFGLSKKTSPEQNCTTYNGTLLYAAPEVISCQPYD
AFAADIWAMGVTIFYVFTGKHPFPDNDRQTMIHLIMNSIYDDSHISDVFIKQIIQRCLQV
DPSLRPSAEVVAKTIRSQIKNSSRKKFIRQAASAKTSASLVLNSKLKRMASSKRISSM
Download sequence
Identical sequences A2FZ69
85666.m00048 gi|121884050|gb|EAX89803.1| gi|123406084|ref|XP_001302733.1| 5722.A2FZ69 XP_001302733.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]