SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123425167|ref|XP_001306744.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123425167|ref|XP_001306744.1|
Domain Number 1 Region: 33-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000141
Family PDI-like 0.041
Further Details:      
 
Domain Number 2 Region: 153-239
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.0000000536
Family ERP29 C domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123425167|ref|XP_001306744.1|
Sequence length 245
Comment hypothetical protein [Trichomonas vaginalis G3]
Sequence
MNNQVHIYDGGMSHDSLNAWLANKTGLIGNSVQSNLLSPNNKTWHQLFNQKSCIFTLFYE
DKFKEKEELLNEMKITADAFQREKDVAVCEINIHKFRSFFFDFKIRKTPRFQLNVNNEEI
LYEGHRNAKDMVSFINSYCDKMRTEKGTLNQNAGIIEEFQPTVIEFLKSPSEKQLKSLLT
KESANVYIDIMKSILDHDVNWIYKESERLQHEFDALPSGSIPSDDEIIRFNVISEFISLK
EDNKL
Download sequence
Identical sequences A2FMQ7
gi|121888335|gb|EAX93814.1| gi|123425167|ref|XP_001306744.1| XP_001306744.1.43485 82116.m00063 5722.A2FMQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]