SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123448667|ref|XP_001313060.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|123448667|ref|XP_001313060.1|
Domain Number - Region: 7-53
Classification Level Classification E-value
Superfamily Flavoproteins 0.000341
Family Flavodoxin-related 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123448667|ref|XP_001313060.1|
Sequence length 57
Comment hypothetical protein [Trichomonas vaginalis G3]
Sequence
MSLKNAKVLILNAGFNHPPMAKGKLNEALANDIEKYLKTKGHETKITHMEQGYKVEE
Download sequence
Identical sequences A2F4M6
5722.A2F4M6 91625.m00092 gi|121894930|gb|EAY00131.1| gi|123448667|ref|XP_001313060.1| XP_001313060.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]