SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123470963|ref|XP_001318684.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123470963|ref|XP_001318684.1|
Domain Number 1 Region: 100-168
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000148
Family UBA domain 0.016
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000987
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123470963|ref|XP_001318684.1|
Sequence length 240
Comment UBA/TS-N domain containing protein [Trichomonas vaginalis G3]
Sequence
MSGRAITLPANKFKALGDVKEVLQSKYFIPKDDIKFLFGVEVLPDKKLVSEIELSRSDFI
MIHQSNSYSKSLNSESKLKSYPRQTVGNPERFADHYSIVKEHAETIEDIQSSRKGIDIQP
EDPSNFRLYVQQLVEMGFEQDKVVELLRKHNYNVPKCLDILIKGVEPEEKPPEKEYDVSD
LAKYNFQEFSELLDDLTNLEKHNLLILLRTHFSVPPIEIIQLFISCDKNMEAVDHNLLDN
Download sequence
Identical sequences A2ELL4
85335.m00126 5722.A2ELL4 XP_001318684.1.43485 gi|121901449|gb|EAY06461.1| gi|123470963|ref|XP_001318684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]