SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123472204|ref|XP_001319297.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123472204|ref|XP_001319297.1|
Domain Number 1 Region: 5-71
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000993
Family Ubiquitin-related 0.031
Further Details:      
 
Domain Number 2 Region: 112-157
Classification Level Classification E-value
Superfamily UBA-like 0.0000000571
Family UBA domain 0.023
Further Details:      
 
Domain Number 3 Region: 194-233
Classification Level Classification E-value
Superfamily UBA-like 0.00000105
Family UBA domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123472204|ref|XP_001319297.1|
Sequence length 236
Comment UBA/TS-N domain containing protein [Trichomonas vaginalis G3]
Sequence
MQGNLEIRSITGNKFVFKANMKHTVHALKKVLSAKLQVDQKNLHFIFHKKELPDNTTVEK
IDIKPDSYIIYYESPKSKDDIVKSQPPTPPQPIVEEPAQEEMIKIDNLEIERSRFDDYVA
FLHNMGFQKNQCVSALKFTHFQLAYAADILCTGNIPKEFSNSEFEKKFSVILDKLRSKKL
NQERIDLISSKFTQDEKKSIRNLIELGISEDQAIQAFIALDRNEAVATNLLISMLE
Download sequence
Identical sequences A2EJT6
XP_001319297.1.43485 84963.m00129 gi|121902077|gb|EAY07074.1| gi|123472204|ref|XP_001319297.1| 5722.A2EJT6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]