SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123477118|ref|XP_001321728.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123477118|ref|XP_001321728.1|
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.46e-36
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0016
Further Details:      
 
Domain Number 2 Region: 175-238
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000000000837
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123477118|ref|XP_001321728.1|
Sequence length 244
Comment Valyl tRNA Synthetase [Trichomonas vaginalis G3]
Sequence
MAHFFHDEFCSVYLEGTKPIVNGDDAAAKEVVAAVLYECIESTMRMLHPFMPYVTEELWQ
HLPRRFNVESIMLAPYPLVNEEWLNYDVSIVDTAFATASAARSIKKQYNINNNNLEAIIV
TSQDEIKPTIPFISAIGGLGKVDVVAPGTQIAAGYASSVVTETVELRINLKGVVDFEKEL
ERLEKKLGPLQQQFQKYEEKISNPNYATKVKPEVQELERSKMEALKVQIEAINKNIQEVK
QLIA
Download sequence
Identical sequences A2ECW0
83746.m00130 gi|121904560|gb|EAY09505.1| gi|123477118|ref|XP_001321728.1| XP_001321728.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]