SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123506681|ref|XP_001329251.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123506681|ref|XP_001329251.1|
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000155
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123506681|ref|XP_001329251.1|
Sequence length 70
Comment hypothetical protein [Trichomonas vaginalis G3]
Sequence
MSAKQAPKMCTLCHSGFDEPCTTCAICMGRDCPVVVGECGCKFHKHCIEGYLGNKRTNCP
GCNAKWAIAK
Download sequence
Identical sequences A2DRA2
90210.m00234 5722.A2DRA2 XP_001329251.1.43485 gi|121912204|gb|EAY17028.1| gi|123506681|ref|XP_001329251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]