SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124808923|ref|XP_001348443.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124808923|ref|XP_001348443.1|
Domain Number 1 Region: 99-237
Classification Level Classification E-value
Superfamily MTH1598-like 6.54e-44
Family MTH1598-like 0.00067
Further Details:      
 
Weak hits

Sequence:  gi|124808923|ref|XP_001348443.1|
Domain Number - Region: 61-119
Classification Level Classification E-value
Superfamily Ribosome binding protein Y (YfiA homologue) 0.0785
Family Ribosome binding protein Y (YfiA homologue) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124808923|ref|XP_001348443.1|
Sequence length 237
Comment conserved protein, unknown function [Plasmodium falciparum 3D7]
Sequence
MSNPFSKKEIISLPQRNRRKVNKSYISEDENEEEENKHIFNGDNNTSDRMDDHINDYVDE
HINDHVDEHINDHVDDHINDYVDDHINKDIYNKFSNKTYEYKYLDHTADIILHSSGKNLR
ECFESICICMFDYMCNLNSVELKKRRKITVSGANIEDLLFNFLTEFHFLYGSEYFICKHI
EIIYFNMNLFLIEAYGYGDIFNISIHESGTEIKAVTKHELKIISNQDACEMFVLVDI
Download sequence
Identical sequences A0A024X060 A0A0L0CT22 A0A0L1I7W8 A0A0L7K795 A0A0L7M6L1 Q8ILH4 W4IAB3 W4IVA9 W7F1E8 W7FLP0 W7JY25
5833.PF14_0269-1 PFHG_00481T0 XP_001348443.1.26446 PFDG_02404T0 gi|124808923|ref|XP_001348443.1| gi|23497337|gb|AAN36882.1| PF14_0269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]