SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146079478|ref|XP_001463798.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146079478|ref|XP_001463798.1|
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily Plus3-like 5.89e-24
Family Plus3 0.0043
Further Details:      
 
Weak hits

Sequence:  gi|146079478|ref|XP_001463798.1|
Domain Number - Region: 220-268
Classification Level Classification E-value
Superfamily RING/U-box 0.0335
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146079478|ref|XP_001463798.1|
Sequence length 275
Comment hypothetical protein [Leishmania infantum JPCM5]
Sequence
MLQRLQLFRSTLVNFLEWRNFSDVVHGCYVRVLLEMRSTEENRRESPDNYYIALVKGAQR
GPVYSGFSADAVTTEWHIVIELPPCFRSTQNGNVVQLNSISNSPFRQAEYQNWVDMTNET
RELSFPSLPQLQFRLGMLEEHKQQALAPEPRRHRNGEDAQAAALRERVLEEKRKRITEEI
MATHVKLRRIDQLKALSLEDLQEVEREILDLITGVRISINERSKCMLCHNRICTEICYPC
KHQVLCKDCAKSIRGRCPAPKCKTPVQYTFEAFTS
Download sequence
Identical sequences A0A2K4YNT6
gi|146079478|ref|XP_001463798.1| 5671.LinJ10.1780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]