SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146094200|ref|XP_001467211.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|146094200|ref|XP_001467211.1|
Domain Number - Region: 2-50
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00132
Family PWWP domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146094200|ref|XP_001467211.1|
Sequence length 490
Comment hypothetical protein [Leishmania infantum JPCM5]
Sequence
MQYPPDTQVWVKCDDGVWWPGTLRETDTEMQAFLCAGEDCCVEFYHSPGELYPLFSADKA
HVRPLHAEPHTRTPEEDAWFANETVAEAAAKALRDYQCCRLLNSPPDGPPAGPAPISERE
NTRDALPFTATELRNIESLLGAVGNSTAARLRQELQQARASVASRGLRRQDAPRRQARKR
QRPAEPPPSPAPPAATHRSVLAAASRPTEEAPTCPRHDPSGVMHALSEALPTARRVAKRS
SGRSSSPLSAGDGEGGDASEEDEDAVPFVQAARRHVLEVLRHEVFENPSRFVLSPVYHFM
DMLGAVVVENSNLTTTLPAPHTLHERPAEGFSPQRRVLLVPLTEAYEHTTGWMVPTEMEG
AQLAMSLYVNDTPVSLPPNWQLSPAKEAAAVKTAMAVDITPLVLSIERDLFSLQVIFSGD
VAEMEMWRGVIACVLVEEVELAQLGERIVSTYHKRRAPVIRRSPLSSCEERGVVAITEVS
GRLVPHTPLS
Download sequence
Identical sequences gi|146094200|ref|XP_001467211.1| 5671.LinJ30.4000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]