SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146102147|ref|XP_001469294.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146102147|ref|XP_001469294.1|
Domain Number 1 Region: 48-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-57
Family RecA protein-like (ATPase-domain) 0.0000000555
Further Details:      
 
Domain Number 2 Region: 2-33
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000267
Family DNA repair protein Rad51, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146102147|ref|XP_001469294.1|
Sequence length 287
Comment RAD51/dmc1 protein [Leishmania infantum]
Sequence
MQCRKDLIQIKGLSEAKVDKIIEAARRVSEVGFITGSSCLQQRSTILRISTGSVALDQLL
GGGGIESRSITEAFGEFRTGKTQIGHTLCVTCQLPLEMGGGNGKAVYVDTEGTFRPERIR
PIAERFGMDSNSVLDNILVARAYTHEHQAHLLSMVAAKMAEDQFSLLVVDSITALFRVDF
SGRGELAERQQKLAKMLSQLMKIAEEFNIAVYITNQVVSDPGGASMFVADPKKPVGGHIL
AHASTTRLSLRKGRGDQRVCKIFDSPSLPELECVYSISEQGIIDAVE
Download sequence
Identical sequences A4IC25 E9BT14
5671.LinJ35.5000 psu|LinJ35_V3.4950 XP_001469294.1.40037 XP_003865072.1.44059 gi|146102147|ref|XP_001469294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]