SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154337479|ref|XP_001564972.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154337479|ref|XP_001564972.1|
Domain Number 1 Region: 385-465
Classification Level Classification E-value
Superfamily YaeB-like 2.35e-32
Family YaeB-like 0.00053
Further Details:      
 
Domain Number 2 Region: 241-305
Classification Level Classification E-value
Superfamily YaeB-like 0.000000235
Family YaeB-like 0.0033
Further Details:      
 
Domain Number 3 Region: 57-87
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000903
Family PWWP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154337479|ref|XP_001564972.1|
Sequence length 492
Comment hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MNASSLLPSPHTTVAVASPIASVASADTATGAAASPTVPVLQHGVSRKRHRVRVNYFLVG
DLVWVRPAKLPYWPAEVIDCDEAANRVRARLIVPPPAAVLAANLAEEQRKHQEQRKREEM
RAIKMYKRGSKPAPPTATGNEALSAHGQPAACTRGVNSDTRSTSCGAAALLPEPQSDVVT
ASGQVVYFFDKLRTTEELDVCLESRLQRSTHDVALYESAFTQAVLQANRLTRISLSPEKL
QPYEVCAVGIVHSLMRAQIEAPRQPNTGTFEPQTGLIRLRTGLENAARDLAGFEFIWVLF
QFSFAAPMASGEGQEMVRKFREAREAGASPDAGPVSPAPVSASDTTPKTEPTADGDGNVC
CYGDTEALMTSTLSFFRQRQGFDRAAGFKTMIIPPRDEEWRGVFATRSPHRPNFIGLSCV
RLVAVHGLNIHIADHDLLHGTPVLDIKPYLPFCDAHPDARAGWVDALDASGNGKGDHKYD
RQAKQVHRATLE
Download sequence
Identical sequences psu|LbrM22_V2.0530 gi|154337479|ref|XP_001564972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]