SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154340265|ref|XP_001566089.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154340265|ref|XP_001566089.1|
Domain Number 1 Region: 135-370
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-56
Family RecA protein-like (ATPase-domain) 0.0000000164
Further Details:      
 
Domain Number 2 Region: 55-119
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000801
Family DNA repair protein Rad51, N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154340265|ref|XP_001566089.1|
Sequence length 374
Comment RAD51 protein [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MQTRSKAKTRRGRPSAQPVEEVEVMESQPQECLQNEEQVFQPQQGTGVAEPNASGFRVIQ
ILENYGVASSDIKKLMEYGFYTVESAAYAPKKAILAVKGISENKAEKIMAECAKLVPMGF
TSAVAYHEARKEIIMVTTGSREVDKLLGGGIETGSITELFGEFRTGKTQLCHTLCVTCQL
PISQGGAEGMALYIDTEGTFRPERLVAVAERYKLDPEDVLANVACARAFNTDHQQQLLLQ
ASAMMAENRFALIIVDSATALYRTDYSGRNELAARQMHLGKFLRSLHNLAEEYGVAVVVT
NQVVANVDGSAQMFQADAKKPIGGHIMAHASTTRLSLRKGRGEQRIIKVYDSPCLAEAEA
IFGIYNDGVGDARD
Download sequence
Identical sequences A4HG95
gi|154340265|ref|XP_001566089.1| psu|LbrM28_V2.0570 XP_001566089.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]