SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154343031|ref|XP_001567461.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154343031|ref|XP_001567461.1|
Domain Number 1 Region: 542-676
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 6.15e-24
Family Staphylococcal nuclease 0.0025
Further Details:      
 
Domain Number 2 Region: 361-509
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.27e-19
Family Staphylococcal nuclease 0.015
Further Details:      
 
Domain Number 3 Region: 168-300
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.4e-19
Family Staphylococcal nuclease 0.0037
Further Details:      
 
Domain Number 4 Region: 742-829
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000162
Family Tudor domain 0.0051
Further Details:      
 
Domain Number 5 Region: 4-143
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000000471
Family Staphylococcal nuclease 0.022
Further Details:      
 
Domain Number 6 Region: 779-929
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000000876
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154343031|ref|XP_001567461.1|
Sequence length 934
Comment hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MSYVVYAVENADRMILMGPTVADQPTFKAITLSYIQAPKLARRMATGEFTPEEPYAYEAA
ELIRSTFIGKQVQFVEDYYIEALQRSAGRIMGANQQEATGMLLKEGLATLPDRMPPRIEK
ELYEIYSLMSAAARAARKGLFSGDGDKHVRQMKSYTPEELAEKIEGIKGQQLLSRVEKVL
SPTLLIISVKELGDTQFAAHLTGITTKDNGNESINTEAKFFIERLLLNRNVKVRYDGLDG
FNNVMISIMSPKGSFQEELLSKGYVKIQNATLPLSTRIDQIISAETSAKKQRVGCWKNYV
EPAGVAPSETAECEWGPHPPCAIGEDDQMDAKVPAAPRVAGLPTTLPDGTPGPVYTGPIE
FVGTLVQVVHGDTVVIRDDASTELRRVSLAGVRSSKNIVRDQDGNSPETRVTYNDYSWEA
KEFLRSRYIGSKVVVFAEYARVMPETKEIRLAATVQVKHTGINIGVALLEAGYATFFLGR
NDKHSKAGELAAAEDGAKEEKKGVHRNTPAPPMKVLELNHLGETRGRYYLSFLQRGMQGN
RPPPLKGVVDLVLGPSSLRVYIPKENFQIPVKVAGIMTPSAAFHPNDKADPFAQEAKDFA
IDLVQQRSVTIQVFTSDRAGNFISSITLGDGTNISVALVAEGFATVANADRLPFAQQLMD
AESAAREAKKHIWSAAGAIPHRALKMEQERAANNPHALTRVLDETSHFVPYVITNIADDG
LSVHLQGYDEVQDTKKGQIQCLLNGAVARESYTPKKGERVIAQYSGDKTWCRATVLKAPR
DGKAEVQFIDFGNTEAVPVQNIRAVPRGPEYALVRETPAFAKLARLAYLKSANQDEMFAG
VACEAVEEYSEGEVLAKAVYRDGFDHVYYTVATSENVPSLSETLLQRGLALLDRRASAVN
PADYRLHEAAQEIARKGHKNLWQYGDIDEGDADY
Download sequence
Identical sequences gi|154343031|ref|XP_001567461.1| psu|LbrM32_V2.1040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]