SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154343886|ref|XP_001567887.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154343886|ref|XP_001567887.1|
Domain Number 1 Region: 115-187
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000000000102
Family Skp1 dimerisation domain-like 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|154343886|ref|XP_001567887.1|
Domain Number - Region: 57-86
Classification Level Classification E-value
Superfamily POZ domain 0.0377
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154343886|ref|XP_001567887.1|
Sequence length 193
Comment hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MTGSVEASPTSNPSPRFCADCVYPSDSTPTRQPVPPAQKVYSSSRPSPPSVPPLPEVEVP
FPYFTGDILERVCRHMSYRFRMSSFGTEDGCYRVYAIKTRIIPRPMTLPLVEYLDMKDRA
FIADWDEFITVQMVKAATLLNYEELLQLASAKLASYLIDRDLEEVRMLLGVKGDFKPAED
AELKKERAVDCLR
Download sequence
Identical sequences A4HLF3
XP_001567887.1.15230 gi|154343886|ref|XP_001567887.1| psu|LbrM33_V2.1180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]