SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154343948|ref|XP_001567918.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154343948|ref|XP_001567918.1|
Domain Number 1 Region: 23-163
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.74e-18
Family Thioltransferase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154343948|ref|XP_001567918.1|
Sequence length 167
Comment hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MSMTQNIVRRIFGDRKLPENLSTEEYDKYMQDNFPKWMKEFEDGGFLEKTKLPPIKSEEE
FIAKLQEHKDELMVIKYWKHGCIPCLTFAEMYKEAAERCTKAKKKVVWYSVDTKAVSTRQ
LIDYQLISGTPTIQTFTGRKQVGNEIRAVNTEELLEELDKRIPKPVL
Download sequence
Identical sequences A4HLI4
psu|LbrM33_V2.1500 gi|154343948|ref|XP_001567918.1| XP_001567918.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]