SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154344266|ref|XP_001568077.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154344266|ref|XP_001568077.1|
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000144
Family PWWP domain 0.01
Further Details:      
 
Domain Number 2 Region: 309-380
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000379
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.004
Further Details:      
 
Weak hits

Sequence:  gi|154344266|ref|XP_001568077.1|
Domain Number - Region: 543-583
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0014
Family Transcriptional factor domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154344266|ref|XP_001568077.1|
Sequence length 586
Comment hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MSASTSADYPVNSWVWVKQHGYPWWPAMVVDPAQTGQDLPEDSNVMLLCGPSTSATLVFA
SSANAEQLRPYHGAIEDAELIEAGRSDESCAAAIEEMIAAVSSADAVPEEEGPPTTPSTS
GATGTHDNHAAAGEGDVSWEALDVETEAAVAEPQNGMAEKRYKKDKKHKKKRNRGGDGGE
HVDRDGAHKARKEKSSKGHRRRRGSDMGSDEEAEARSNTGEDDSGNDEDVFQRFTGAASS
RSAIKKAKYERQSKLEEYDLGPGTLPDYSPRDDPAYYYRKVHSARRSASSTELQTCTQEL
RGFMSQCLSGAATATDVETDILGVLRKLKNINVTVTQLQETGVGVAVGNLLRSFTAPVVQ
LAQAILNYWFHSLPQSMQQQLSAENEVDRCSIETCSDGVAGENELGRIGVNLFGCFTNEE
INDSLASVDVMALCGTIEDALERSCDVDAQMLVLSAFGDAGDTGKALRRLLLEGKIYVED
IIKNAGDLPSLVRRRQHCPPNLQLVSNSPTSQDRSDIGSPTSPNDDDSAGSPIFGSPAGR
TTTALYSCPHCGANDAYQSSYSVQAHDNLPDILRCKKCEQTWNVAE
Download sequence
Identical sequences A4HLZ3
gi|154344266|ref|XP_001568077.1| psu|LbrM33_V2.3100 XP_001568077.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]