SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154416397|ref|XP_001581221.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154416397|ref|XP_001581221.1|
Domain Number 1 Region: 17-76
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000314
Family DNA repair protein Rad51, N-terminal domain 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|154416397|ref|XP_001581221.1|
Domain Number - Region: 58-115
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000277
Family RecA protein-like (ATPase-domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154416397|ref|XP_001581221.1|
Sequence length 115
Comment DNA repair protein RAD51 homolog [Trichomonas vaginalis G3]
Sequence
MGSHNFRHSRLRVVQPFFPLEQQGIAAGDIKKLQEGGYNTVESIAFTTKKLLVAVKGISE
AKADKIMAAAAALVPMGFASATDYNQIRKEMVYLSTGSSELDKLLGGGIKTGSVT
Download sequence
Identical sequences A2DHG2
gi|121915446|gb|EAY20235.1| gi|154416397|ref|XP_001581221.1| 5722.A2DHG2 XP_001581221.1.43485 80906.m00276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]